PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco015105.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MIKC_MADS
Protein Properties Length: 247aa    MW: 28217.2 Da    PI: 8.2885
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco015105.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.51.3e-31959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++gklye++s
  Aco015105.1  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCS 59
                 79***********************************************96 PP

2K-box96.34.7e-328917613100
        K-box  13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                   ++s++qe+ kLk+ +e+Lqr+qR+llGedL++Ls+keL+qLe+qL++sl++iRs++++++l+q+ +lq++e+ l e+nk+Lrk+lee
  Aco015105.1  89 LMQSSCQEYMKLKAHVESLQRSQRNLLGEDLGTLSIKELEQLEKQLDTSLRHIRSTRTQHMLDQLADLQRREQVLCEANKCLRKRLEE 176
                  5799********************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.165161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.16E-33281IPR002100Transcription factor, MADS-box
CDDcd002656.12E-46276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-33323IPR002100Transcription factor, MADS-box
PfamPF003191.6E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-333859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129715.28890180IPR002487Transcription factor, K-box
PfamPF014863.6E-2691174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0048481Biological Processplant ovule development
GO:0048833Biological Processspecification of floral organ number
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIVFSN RGKLYEFCSS  60
PSMLKTLERY QKCSYSAPEM STQSKEVLLM QSSCQEYMKL KAHVESLQRS QRNLLGEDLG  120
TLSIKELEQL EKQLDTSLRH IRSTRTQHML DQLADLQRRE QVLCEANKCL RKRLEESSQG  180
SVELQVWEHG ANQLGGGYDR QQSPQEPHGN GFFHPLECEP SLHIGYHHDQ MPGTSVATFM  240
PPGWLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A4e-33751761103Developmental protein SEPALLATA 3
4ox0_B4e-33751761103Developmental protein SEPALLATA 3
4ox0_C4e-33751761103Developmental protein SEPALLATA 3
4ox0_D4e-33751761103Developmental protein SEPALLATA 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00605ChIP-seqTransfer from AT1G24260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001289804.11e-126MADS-box transcription factor 8
SwissprotQ9SAR11e-125MADS8_ORYSJ; MADS-box transcription factor 8
TrEMBLQ6TYI71e-131Q6TYI7_ASPOF; MADS box protein
STRINGBRADI4G34680.11e-126(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34833469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.11e-103MIKC_MADS family protein